PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462848999
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 137aa    MW: 15052.5 Da    PI: 10.8537
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462848999genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3629.8e-206703399
               -SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
         B3 33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
               ++t+  +d +g++W++++iyr++++r++lt+GW+ Fv++++L +gD++vF   +++ +el+v+++r+
  462848999  6 TTTVLAKDVHGEVWKFRHIYRGTPRRHLLTTGWSTFVNQKKLVAGDSIVFL--RTELGELCVGIRRA 70
               568999*********************************************..559999******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd100176.48E-15169No hitNo description
PROSITE profilePS5086312.689171IPR003340B3 DNA binding domain
SuperFamilySSF1019361.57E-18572IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.0021671IPR003340B3 DNA binding domain
PfamPF023621.5E-17670IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.5E-22673IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MGGGGTTTVL AKDVHGEVWK FRHIYRGTPR RHLLTTGWST FVNQKKLVAG DSIVFLRTEL  60
GELCVGIRRA KRVSCGGMEC MSGWNAPGYG GFSPFLKEEE SKLMKGPGGY MRGRGKVKIA  120
DVVDAASLAA RRAYRMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A5e-22672195261Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0604671e-110BT060467.1 Zea mays full-length cDNA clone ZM_BFb0003E21 mRNA, complete cds.
GenBankEU9670251e-110EU967025.1 Zea mays clone 298928 mRNA sequence.
GenBankHM0045171e-110HM004517.1 Zea mays auxin response factor 2 (ARF2) gene, complete cds.
GenBankJX4285041e-110JX428504.1 Zea mays subsp. mays clone pUT3102 ARF2 ARF type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982839.14e-76PREDICTED: auxin response factor 22
SwissprotQ9AV471e-62ARFV_ORYSJ; Auxin response factor 22
TrEMBLA0A0D9XKQ21e-76A0A0D9XKQ2_9ORYZ; Auxin response factor
TrEMBLK4A6M04e-76K4A6M0_SETIT; Auxin response factor
STRINGSi034525m1e-75(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30080.18e-47auxin response factor 16